PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2128s0071.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 237aa    MW: 27046.5 Da    PI: 8.8634
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2128s0071.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1880132456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + ++t+ ql  Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  Bostr.2128s0071.2.p  80 KKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 132
                          45699***********************************************9 PP

2HD-ZIP_I/II116.71.3e-3779169292
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                          kk+rl++ q+++LE+sF+ee kL+++rKv+l+reLglqprq+avWFqnrRAR+k+kqlE+ y++L+++yd +++e+++L++ev++Lr+ l
  Bostr.2128s0071.2.p  79 KKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLRAIL 168
                          9**************************************************************************************877 PP

          HD-ZIP_I/II  92 k 92 
                          +
  Bostr.2128s0071.2.p 169 R 169
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.06E-1867136IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-1972137IPR009057Homeodomain-like
PROSITE profilePS5007116.64974134IPR001356Homeobox domain
SMARTSM003891.7E-1676138IPR001356Homeobox domain
CDDcd000863.08E-1579135No hitNo description
PfamPF000464.3E-1680132IPR001356Homeobox domain
PRINTSPR000314.2E-5105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000314.2E-5114130IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEWSTMSNVE NVRVAFMPPP WPESSSFNSL HSFSFDPYAG NLYTPPADTQ TGPVISVPEP  60
EKIMNAYRYP NNNNNEMIKK KRLTSGQLAS LERSFQEEIK LDSDRKVKLS RELGLQPRQI  120
AVWFQNRRAR WKAKQLEQLY DSLRQEYDVV SREKQMLHDE VKKLRAILRD QGLFKKPISA  180
GTIKVSSEEE TAELPSVVVA HPRTENLNTG GNQIYGTDQY NNPMMVASSG WSSYPC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARWKAKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3520291e-167EU352029.1 Arabidopsis lyrata At5g03790-like protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010490871.11e-161PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR01e-154ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLR0FIS61e-161R0FIS6_9BRAS; Uncharacterized protein
STRINGAT5G03790.11e-151(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-140homeobox 51